PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_11409_iso_4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 275aa    MW: 29131.2 Da    PI: 7.1624
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_11409_iso_4genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF82244.94.4e-142610068150
                                DUF822  68 tyrkgskpleeaeaagssasaspesslqsslkssalaspvesysaspksssfpspssldsislasaasllpvl 140
                                           ty kg+kp ++++++g s++asp+ss+q        +sp +sy++sp+sssfpsp+s+  + +a+ +sl+p+l
  cra_locus_11409_iso_4_len_1119_ver_3  26 TYIKGCKPVDRMDIMGGSTTASPCSSYQ--------PSPGTSYNPSPASSSFPSPTSSYANVNADGNSLIPWL 90 
                                           899*************************........*************************9*9********* PP

                                DUF822 141 svlslvsssl 150
                                           ++ls++sss+
  cra_locus_11409_iso_4_len_1119_ver_3  91 KNLSSASSSA 100
                                           ***9987765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.1E-122694IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
XFWVKNDWKF SPFLLGRALH YLIFGTYIKG CKPVDRMDIM GGSTTASPCS SYQPSPGTSY  60
NPSPASSSFP SPTSSYANVN ADGNSLIPWL KNLSSASSSA SSSKFHHLYH GGSISAPVTP  120
PLSSPTCQTP RMKTNWDDSS ARAFWGGSHH SFLPLSTPPS PGRPIIPDSE WFAGSGGPTS  180
PTFSLVSSNP FGFKFGNIGR SGSLMCTPGQ SGTCSPAIPP GADQTADVPM AEVISDEFAF  240
GNIRGGLVKP WEGERIHEDA GLDDLELTLG SSKTR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010644097.11e-111PREDICTED: BES1/BZR1 homolog protein 4
SwissprotQ9ZV884e-90BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A068UCW31e-119A0A068UCW3_COFCA; Uncharacterized protein
TrEMBLF6H1V61e-112F6H1V6_VITVI; Putative uncharacterized protein
STRINGVIT_19s0014g00870.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19842464